91001 plasmid pPCP1, complete sequence'
>>># Access features list and example feature at index 14 if available >>>if len(seq_record.features) > 14: ... print(seq_record.features) ...else: ... print("Feature index 14 not available")
type: CDS location: [6115:6421](+) qualifiers: Key: codon_start, Value: ['1'] Key: inference, Value: ['COORDINATES: similar to AA sequence:RefSeq:WP_002221218.1'] Key: locus_tag, Value: ['YP_RS22235'] Key: note, Value: ['Derived by automated computational analysis using gene prediction method: Protein Homology.'] Key: old_locus_tag, Value: ['pPCP07', 'YP_pPCP07'] Key: product, Value: ['hypothetical protein'] Key: protein_id, Value: ['WP_002221218.1'] Key: transl_table, Value: ['11'] Key: translation, Value: ['MSKTKSGRHRLSKTDKRLLAALVVAGYEERTARDLIQKHVYTLTQADLRHLVSEISNGVGQSQAYDAIYQAR
Dostęp do baz online Za pośrednictwem modułu Bio.Entrez użytkownicy Biopythona mogą pobierać dane biologiczne z baz danych NCBI. Wszystkie funkcje wyszukiwarki Entrez są dostępne za pośrednictwem funkcji tego modułu, w tym wyszukiwanie i pobieranie rekordów.
>>>#This code fetches nucleotide sequence records from the NCBI database for specified accession IDs, reads the GenBank-formatted data and prints the first two lines.